PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR12G03230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 203aa    MW: 22177 Da    PI: 8.488
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR12G03230.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.44.7e-11126188163
                      XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      eke kr rr   NRe+Ar   +R++a  +eL++kv+ L+++N+++kke e+  +e+ +lk  +
  LPERR12G03230.1 126 EKEAKRLRRVLANRESARQTILRRQAIRDELARKVADLSTQNESMKKERETVMQEYLSLKETN 188
                      89**********************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.7E-6123191No hitNo description
SMARTSM003381.9E-12126190IPR004827Basic-leucine zipper domain
PfamPF001708.7E-10126189IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.14128191IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.05E-7130186No hitNo description
CDDcd147024.84E-11131181No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MSEYGDEQQQ RQCHRRRGGD VAPVDVVELG AALALADMAG AVAAKKAVAA APPPPMMQDE  60
DEEMATTRLS LQLGNNSNNI HSSSCSSSGS SAGRPAPPPP PPAANVTATS SGYGCIKPRQ  120
MLTEEEKEAK RLRRVLANRE SARQTILRRQ AIRDELARKV ADLSTQNESM KKERETVMQE  180
YLSLKETNKQ LKEQAHHLSL SLF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006663833.12e-76PREDICTED: G-box-binding factor 1-like
TrEMBLA0A0D9XX201e-148A0A0D9XX20_9ORYZ; Uncharacterized protein
STRINGOB12G13360.15e-76(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP31653475
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.13e-18bZIP family protein